Gene Bio Systems
Recombinant Acinetobacter sp. UPF0756 membrane protein ACIAD2383(ACIAD2383)
Recombinant Acinetobacter sp. UPF0756 membrane protein ACIAD2383(ACIAD2383)
SKU:CSB-CF739120AWW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acinetobacter sp. (strain ADP1)
Uniprot NO.:Q6F9V4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLMSQFDVNLLVLLVLLACGIFSQNAAVTIAAGVLIVFKLTPLSEFFPFLQQHGLNVGVI ILTIGVLTPIASGKLSGETILKSFFSYKSILAITVGLLVAWLGGRGVKLMSSQPDIVAGL LIGTVAGVALLRGVPVGPLIAAGILSLVLWN
Protein Names:Recommended name: UPF0756 membrane protein ACIAD2383
Gene Names:Ordered Locus Names:ACIAD2383
Expression Region:1-151
Sequence Info:full length protein
