Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acinetobacter sp. UPF0756 membrane protein ACIAD2383(ACIAD2383)

Recombinant Acinetobacter sp. UPF0756 membrane protein ACIAD2383(ACIAD2383)

SKU:CSB-CF739120AWW

Regular price €1.433,95 EUR
Regular price Sale price €1.433,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acinetobacter sp. (strain ADP1)

Uniprot NO.:Q6F9V4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLMSQFDVNLLVLLVLLACGIFSQNAAVTIAAGVLIVFKLTPLSEFFPFLQQHGLNVGVI ILTIGVLTPIASGKLSGETILKSFFSYKSILAITVGLLVAWLGGRGVKLMSSQPDIVAGL LIGTVAGVALLRGVPVGPLIAAGILSLVLWN

Protein Names:Recommended name: UPF0756 membrane protein ACIAD2383

Gene Names:Ordered Locus Names:ACIAD2383

Expression Region:1-151

Sequence Info:full length protein

View full details