Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acidithiobacillus ferrooxidans Probable intracellular septation protein A (AFE_0667)

Recombinant Acidithiobacillus ferrooxidans Probable intracellular septation protein A (AFE_0667)

SKU:CSB-CF476518AWH

Regular price €1.468,95 EUR
Regular price Sale price €1.468,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / NCIB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270))

Uniprot NO.:B7J5W3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLLTDFLPIILFFVAYRIHGIYTATEVLIVAAILLMAWQWWRRGRVETMTWVSTLLILT FGGLTLYFHNDTFIKIKPSILYVLFAAALLFTHWREEPLLQRLMGGQLPAALPLSFWRRL NGYWIAFFLFGAVLNLIVAYAFSTGIWVDFKLFGMLAITVIFVLFQAVVISRALPQEAKD GDSSA

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:AFE_0667

Expression Region:1-185

Sequence Info:full length protein

View full details