Gene Bio Systems
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R495(MIMI_R495)
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R495(MIMI_R495)
SKU:CSB-CF716492ADAZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acanthamoeba polyphaga mimivirus (APMV)
Uniprot NO.:Q5UQG5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSCITTNNVKRLIILIIFVVIIWQFYYYASSKHNNNFLNEKIAIVPHDIKCLFNQPNCSE ADVDGWSLVQAFIYFVVGLIIPNKYLIIIIVSIILEILKPFIGYEPKYIIGPLLNTTGYI VGSMLSPCKNNYKEKYQIFE
Protein Names:Recommended name: Uncharacterized protein R495
Gene Names:Ordered Locus Names:MIMI_R495
Expression Region:1-140
Sequence Info:full length protein
