Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acanthamoeba polyphaga mimivirus Probable FAD-linked sulfhydryl oxidase R368(MIMI_R368)

Recombinant Acanthamoeba polyphaga mimivirus Probable FAD-linked sulfhydryl oxidase R368(MIMI_R368)

SKU:CSB-CF713281ADAZ

Regular price €1.430,95 EUR
Regular price Sale price €1.430,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acanthamoeba polyphaga mimivirus (APMV)

Uniprot NO.:Q5UQV6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPEQWGIYGWTFSHAVALGYPINPTEEDKLRYYTFFNSYRYVLPCGKCRINYADHLNKY PLTDEVLSSRENLVKWTIDIHNVVNYYTGKKMLTYPEAIEAIEKTLTPKKKSSYNWFFII LIIIGIIVIIYLMYIVFKKKLNK

Protein Names:Recommended name: Probable FAD-linked sulfhydryl oxidase R368 EC= 1.8.3.2

Gene Names:Ordered Locus Names:MIMI_R368

Expression Region:1-143

Sequence Info:full length protein

View full details