Gene Bio Systems
RecombinantMouseAquaporin-4(Aqp4),partial
RecombinantMouseAquaporin-4(Aqp4),partial
SKU:CSB-YP001964MO1
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P55088
Gene Names: Aqp4
Organism: Mus musculus (Mouse)
AA Sequence: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV
Expression Region: 253-323aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 9.9 kDa
Alternative Name(s): Mercurial-insensitive water channel
Relevance: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
Reference: "Defective secretion of saliva in transgenic mice lacking aquaporin-5 water channels." Ma T., Song Y., Gillespie A., Carlson E.J., Epstein C.J., Verkman A.S. J. Biol. Chem. 274:20071-20074(1999)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
