Skip to product information
1 of 1

Gene Bio Systems

Recombinant Zea mays CASP-like protein 7

Recombinant Zea mays CASP-like protein 7

SKU:CSB-CF467295ZAX

Regular price €1.492,95 EUR
Regular price Sale price €1.492,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Zea mays (Maize)

Uniprot NO.:B6SR79

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKTAGVGRLGGARAADAAQQQQLAAGDAAVARAARPIETLLRAAPLVLCVAAMTLMLRD QQSNEYGTVAYSDLGGFKYLVYANGLCAAYSLASAFYTAVPRPATVSRSWVVFLLDQVFT YLILAAGAAAAELLYLAYNGDKEVTWSEACGVFGSFCRQARISVAITFGAVLCFILLSLL SSYRLFSAYEAPPPSALGSKGVEIAAYPR

Protein Names:Recommended name: CASP-like protein 7 Alternative name(s): Salicylic acid-induced protein 1-B

Gene Names:

Expression Region:1-209

Sequence Info:full length protein

View full details