Skip to product information
1 of 1

Gene Bio Systems

Recombinant Zea mays CASP-like protein 12

Recombinant Zea mays CASP-like protein 12

SKU:CSB-CF478390ZAX

Regular price €1.469,95 EUR
Regular price Sale price €1.469,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Zea mays (Maize)

Uniprot NO.:B6TUW9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGAAGLKVPEMALRLCVVPLSLASLWEMASNAQADDTYGEVKFSDLSGFSYLVGVNAVTA AYAVASVLASSFKRPLAARYDWVVLVMDQASAYLLVTSASAAAELLQLARHGDRGVSWGE ACSYFGRFCGKATVSLALHAAALACFAALSLVSAFRVFSSRCHPPPDADGQPPKHARDEE QRVYHY

Protein Names:Recommended name: CASP-like protein 12 Alternative name(s): Protein salicylic acid-induced 1

Gene Names:

Expression Region:1-186

Sequence Info:full length protein

View full details