Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia pestis bv. Antiqua Ferrous iron permease EfeU(efeU)

Recombinant Yersinia pestis bv. Antiqua Ferrous iron permease EfeU(efeU)

SKU:CSB-CF615420YAF

Regular price €1.567,95 EUR
Regular price Sale price €1.567,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Yersinia pestis bv. Antiqua (strain Antiqua)

Uniprot NO.:Q1C8M3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFVPFLIMFREGLEAALIVSLIASYLKRTQRGQWMGAVWVGVVVAAVLCLAIGIFINETT GEFPQKQQELFEGIIAVVAVCILTYMVFWMRKVSKSVKVHLEGAIDNALNSGRGQGWALV AMVFFAVAREGLESVFFLLAAFQQDVGIGAPIGAILGLVCAILVGMAIYWGGVKLHLAKF FKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQDIAFDLTDVLSTHSLLGTFLEGMFGYQ EAPTVSEVSVYFIYLIPALILFFLPPRSTAGSAIAAARKINP

Protein Names:Recommended name: Ferrous iron permease EfeU Alternative name(s): Fe(2+) ion permease EfeU Ferrous iron uptake protein

Gene Names:Name:efeU Ordered Locus Names:YPA_1232

Expression Region:1-282

Sequence Info:full length protein

View full details