Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia enterocolitica serotype O:8 - biotype 1B UPF0299 membrane protein YE2790 (YE2790)

Recombinant Yersinia enterocolitica serotype O:8 - biotype 1B UPF0299 membrane protein YE2790 (YE2790)

SKU:CSB-CF374767YAK

Regular price €1.421,95 EUR
Regular price Sale price €1.421,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)

Uniprot NO.:A1JTY1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRNVTSLGWQYLRAFVIIYLCLWAGKAVTLLLPISIPGSILGMLILFALLSSQILPSTWV KPGCHLLIRYMALLFVPIGVGVMQYYDQLTKQFGPIVVSCFVSTLVVMLVVGYSSHYVHR ERKVMGSPTHTEEDK

Protein Names:Recommended name: UPF0299 membrane protein YE2790

Gene Names:Ordered Locus Names:YE2790

Expression Region:1-135

Sequence Info:full length protein

View full details