Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xylella fastidiosa UPF0059 membrane protein PD_1297(PD_1297)

Recombinant Xylella fastidiosa UPF0059 membrane protein PD_1297(PD_1297)

SKU:CSB-CF773113XAT

Regular price €1.473,95 EUR
Regular price Sale price €1.473,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xylella fastidiosa (strain Temecula1 / ATCC 700964)

Uniprot NO.:Q87BZ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPITTLLIGIAMSTDAFAAAIGKGAAIGKPRLRDALYVAVIFGVIETATPIAGWLLGQV ASHYIATFDHWIAFGLLGGLGIHMIVNGLKNNGNTCKDNADTHNRNSRWLTLAATALATS IDAAAIGISMAFLDIHIGIVAAVIGLCTFTMVIFGVMLGRVLGTFVGNRAEIVGGIILII VGSTILYEHLSNTG

Protein Names:Recommended name: UPF0059 membrane protein PD_1297

Gene Names:Ordered Locus Names:PD_1297

Expression Region:1-194

Sequence Info:full length protein

View full details