Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Aspartate beta-hydroxylase domain-containing protein 2(asphd2)

Recombinant Xenopus tropicalis Aspartate beta-hydroxylase domain-containing protein 2(asphd2)

SKU:CSB-CF002228XBF

Regular price €1.656,95 EUR
Regular price Sale price €1.656,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:B5DE73

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVWALPRTSSPSCIAPSYKPDSGWIKMSAEWLIDWSCLLNGLRDLIAGCIQAVRDCNSFALTTVICLLMLFAWYCYRVGKDQPRSPFATVNLLIQSSEAKGLQNGFAYCHSRECVRCTHNDGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYLNNRPSIQKPEVFFLPDLPTMPYFPRDAQKHDVELLEQNFATILSEFEAIYKAFSNCSLPQGWKVNSTPSGEWFTFYLVNQGVTIPSNCKKCPRTYRLLGNLRTFIGNNVFGNACISVLTPGTVITEHYGPTNIRIRCHLGLRIPGNCELVVGGEPQCWAEGHCLLFDDSFLHTAFHEGSAEEGPRVIFMVDLWHPNVAAAERQALDSIFAPGR

Protein Names:Recommended name: Aspartate beta-hydroxylase domain-containing protein 2 EC= 1.14.11.-

Gene Names:Name:asphd2

Expression Region:1-370

Sequence Info:full length protein

View full details