Gene Bio Systems
Recombinant Xenopus laevis Transmembrane protein 47(tmem47)
Recombinant Xenopus laevis Transmembrane protein 47(tmem47)
SKU:CSB-CF023845XBE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q6IP19
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASSASGMEEVRSSVLTPLKLVGLVCIFLALCLDIGAVLSPAWVTADNQYYLSLWESCKK SENRWICDSTLQSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLFAA VVLQVCGLVLYPIKFIETVTLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDYY
Protein Names:Recommended name: Transmembrane protein 47 Alternative name(s): Transmembrane 4 superfamily member 10
Gene Names:Name:tmem47 Synonyms:tm4sf10
Expression Region:1-179
Sequence Info:full length protein
