Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Secretory carrier-associated membrane protein 5A(scamp5-a)

Recombinant Xenopus laevis Secretory carrier-associated membrane protein 5A(scamp5-a)

SKU:CSB-CF740108XBE

Regular price €1.519,95 EUR
Regular price Sale price €1.519,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6GPA8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDKPNNFPPLPRFIPLKPCFYQDFDTDIPDLHRTTAKRLYYLWMLNSITLGVNLIGCLA WLIGGGSATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFNFMAFFFTFTAQLVISI IQAVGIPGWGVCGWIASISFFGTNVGSAVVMLIPTIMFTAVAVLSFVALTKVHRFYRGAG GSLSKAQEEWTTGAWKNPHVQQAAQNAAFGATQGAMTQNEPQYSATPNYGYSNEM

Protein Names:Recommended name: Secretory carrier-associated membrane protein 5A Short name= Secretory carrier membrane protein 5 A

Gene Names:Name:scamp5-a

Expression Region:1-235

Sequence Info:full length protein

View full details