Gene Bio Systems
Recombinant Xenopus laevis Melatonin receptor type 1A X2.0
Recombinant Xenopus laevis Melatonin receptor type 1A X2.0
SKU:CSB-CF342722XBE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:P51048
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:HSSWYNRLFSNSGTICYVGLVWVLALGAILPNLFVGSLRCDPRIFSCTFAQYVSSYYTIA VVIFHFFLPIGVVSYCYLRIWVLVLNIRHRVKPDRHLHHQTWPYNIHGFITMFVVFVLFA VCWGPLNIIGLTVAIYPPLGDSIPQWLFVASYF
Protein Names:Recommended name: Melatonin receptor type 1A X2.0 Short name= Mel-1A-R X2.0 Short name= Mel1a receptor X2.0
Gene Names:
Expression Region:1-153
Sequence Info:full length protein
