Gene Bio Systems
Recombinant Xanthobacter autotrophicus UPF0060 membrane protein Xaut_1380 (Xaut_1380)
Recombinant Xanthobacter autotrophicus UPF0060 membrane protein Xaut_1380 (Xaut_1380)
SKU:CSB-CF416343XAV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Uniprot NO.:A7IF35
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTLPAFLFAALGEIAGCFAVWHVVRLGGSHWWLLPGIVSLAAFAYALTFVEAEAAGRAFA AYGGIYILSSLVWMWTVEGVRPDRWDATGAALCLAGAAVIVFGPRG
Protein Names:Recommended name: UPF0060 membrane protein Xaut_1380
Gene Names:Ordered Locus Names:Xaut_1380
Expression Region:1-106
Sequence Info:full length protein
