Gene Bio Systems
Recombinant Volvox carteri Cytochrome b6-f complex subunit petO, chloroplastic(PETO)
Recombinant Volvox carteri Cytochrome b6-f complex subunit petO, chloroplastic(PETO)
SKU:CSB-CF890301VDT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Volvox carteri (Green alga)
Uniprot NO.:Q9SBM5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GVVLQQPELKKVFQDDAPAPAPVKREFKGLAPPSLPKPVEAPKPAAVAAAPEKKEEVKES GSDLDPRSIALPGALALTIGGFFAASKIDTSFNEWFIEAVVKDSNNYAGYEATLKTDAGV VFPKAATAGTKKVKAATGSKKGGFPFGGKK
Protein Names:Recommended name: Cytochrome b6-f complex subunit petO, chloroplastic Alternative name(s): Cytochrome b6-f complex subunit V Short name= suV Cytochrome b6-f-associated phosphoprotein
Gene Names:Name:PETO
Expression Region:54-203
Sequence Info:full length protein
