Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vitis vinifera Casparian strip membrane protein VIT_08s0007g02880 (VIT_08s0007g02880)

Recombinant Vitis vinifera Casparian strip membrane protein VIT_08s0007g02880 (VIT_08s0007g02880)

SKU:CSB-CF417265VFQ

Regular price €1.497,95 EUR
Regular price Sale price €1.497,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7PP95

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSGANATTIDVPETRAEAKGKAPLIAAPIVATTKATPHPNAGWKKGLAIFDFLLRLAAI AATLAAATTMGTTDETLPFFTQFFQFQASFDDLPAFMFFVVATAIASGYLALSLPFSLVS IFRPHAQGIRLLLIISDTVMLALTTAGAASATAIVYLAHNGDSSANWIAICQQFTDFCQS VSGAVVASFIAVVIFMLLVMMSALALRKH

Protein Names:Recommended name: Casparian strip membrane protein VIT_08s0007g02880

Gene Names:Ordered Locus Names:VIT_08s0007g02880 ORF Names:GSVIVT00021563001, GSVIVT01033894001, VIT_00033894001, Vv08s0007g02880

Expression Region:1-209

Sequence Info:full length protein

View full details