Gene Bio Systems
Recombinant Vibrio fischeri UPF0208 membrane protein VF_0838(VF_0838)
Recombinant Vibrio fischeri UPF0208 membrane protein VF_0838(VF_0838)
SKU:CSB-CF691587VFB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vibrio fischeri (strain ATCC 700601 / ES114)
Uniprot NO.:Q5E6L3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSENGFLFRFRDGQTYMDTWPERKELAPMFPEQRVIKATKFAVKVMPAVAVISVLTQMVF NNTAGLPQAIIIALFAISMPLQGFWWLGNRANTKLPPALASWYRELYQKIIESGAALEPM KSQPRYKELANILNKAFKQLDKTALERWF
Protein Names:Recommended name: UPF0208 membrane protein VF_0838
Gene Names:Ordered Locus Names:VF_0838
Expression Region:1-149
Sequence Info:full length protein
