
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Uniprot NO.:Q9KNS2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFLLWCKELIVINTNPKRSDEPVWWSLFGAGGTWFAMITPITVLVLGILAPLGVIDAEAL SYERVSSFATSIIGALFIIGTLALPMWHAMHRVHHGMHDLKFHTGVAGKIACYGFATIIS ALAVVFIFMI
Protein Names:Recommended name: Fumarate reductase subunit D
Gene Names:Name:frdD Ordered Locus Names:VC_2659
Expression Region:1-130
Sequence Info:full length protein
You may also like
-
Recombinant Vibrio cholerae serotype O1 Fumarate reductase subunit C(frdC)
- Regular price
- €1.035,95 EUR
- Sale price
- €1.035,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Vibrio cholerae serotype O1 Fumarate reductase subunit D(frdD)
- Regular price
- €1.038,95 EUR
- Sale price
- €1.038,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Vibrio cholerae serotype O1 Fumarate reductase subunit C(frdC)
- Regular price
- €1.035,95 EUR
- Sale price
- €1.035,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Vibrio cholerae serotype O1 Fumarate reductase subunit C(frdC)
- Regular price
- €1.035,95 EUR
- Sale price
- €1.035,95 EUR
- Regular price
-
- Unit price
- per
Sold out