Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vesicular stomatitis Indiana virus Protein C'(P)

Recombinant Vesicular stomatitis Indiana virus Protein C'(P)

SKU:CSB-EP768100VBH

Regular price €864,95 EUR
Regular price Sale price €864,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: p

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV)

Delivery time: 3-7 business days

Uniprot ID: Q86132

AA Sequence: MRSKHNELKSPIMSCSKRTEWKSILGPLIFRQQMILTQNLNQKLKTIKACMYQIRKLSKLKALYRGL

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-67aa

Protein length: Full Length

MW: 11.9 kDa

Alternative Name(s):

Relevance: May play a role in viral pathogenesis or transmission by insects vectors.

Reference: "Cloning and expression of a viral phosphoprotein: structure suggests vesicular stomatitis virus NS may function by mimicking an RNA template." Hudson L.D., Condra C., Lazzarini R.A. J. Gen. Virol. 67:1571-1579(1986)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details