Skip to product information
1 of 1

Gene Bio Systems

Recombinant Variola virus Virion membrane protein A9 (A9L)

Recombinant Variola virus Virion membrane protein A9 (A9L)

SKU:CSB-CF327265VAR

Regular price €1.354,95 EUR
Regular price Sale price €1.354,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Uniprot NO.:P33835

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AIDLCRHFFMYFCEQKLRPNSFWFVVVRAIASMIMYLVLGIALLYISEQDDKKNTNNASN SNKLNESSINSNS

Protein Names:Recommended name: Virion membrane protein A9

Gene Names:ORF Names:A9L

Expression Region:23-95

Sequence Info:full length protein

View full details