Skip to product information
1 of 1

Gene Bio Systems

Recombinant Variola virus Protein F9 (C13L, F9L)

Recombinant Variola virus Protein F9 (C13L, F9L)

SKU:CSB-CF339392VAR

Regular price €1.501,95 EUR
Regular price Sale price €1.501,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Uniprot NO.:P33869

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAETKEFKTLYNLFIDSYLQKLAQHSIPTNVTCAIHIGEVIGQFKNCALRITNKCMSNTR LSFTLMVESFIEVISLLPEKDRRAIAEEIGIDLNDVPSAVSKLEKNCNAYAEVNNIIDIQ KLNIGECSAPPGQHMLLQIVNTGSAGANCGLQTILKSLNKIYVPPIIENRLPYYDPWFLV GVAIILVIFTVAICSIRRNLALKYRYGTFLYV

Protein Names:Recommended name: Protein F9

Gene Names:ORF Names:C13L, F9L

Expression Region:1-212

Sequence Info:full length protein

View full details