Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vanderwaltozyma polyspora Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

Recombinant Vanderwaltozyma polyspora Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

SKU:CSB-CF025866VDW

Regular price €1.353,95 EUR
Regular price Sale price €1.353,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Uniprot NO.:A7TSA7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPVDVAPGVIKKLMFFTAAMVICPLLTFFSIKQFTTNTIVSGGLAALAANLVLIGYIVVAFMEDTTDVKAESKKD

Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21

Gene Names:Name:VMA21 ORF Names:Kpol_359p4

Expression Region:1-75

Sequence Info:full length protein

View full details