Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vaccinia virus Virion membrane protein A9(VACWR128)

Recombinant Vaccinia virus Virion membrane protein A9(VACWR128)

SKU:CSB-CF774634VAI

Regular price €1.369,95 EUR
Regular price Sale price €1.369,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Uniprot NO.:Q85320

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AIDLCRHFFMYFCEQKLRPNSFWFVVVRAIASMIMYLVLGIALLYISEQDDKKNTNNANT NNDSNSNNSNNDKRNESSINSNSSPK

Protein Names:Recommended name: Virion membrane protein A9

Gene Names:Ordered Locus Names:VACWR128 ORF Names:A9L

Expression Region:23-108

Sequence Info:full length protein

View full details