Recombinant Vaccinia virus Pseudokinase OPG198 (B12)

SKU: P21098

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P21098

Gene Names: B12

Alternative Name(s):

Abbreviation: Recombinant Vaccinia virus B12 protein

Organism: Vaccinia virus (strain Copenhagen) (VACV)

Source: E.coli

Expression Region: 1-283aa

Protein Length: Full Length

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: MESFKYCFDNDGKKWIIGNTLYSGNSILYKVRKNFTSSFYNYVMKIDHKSHKPLLSEIRFYISVLDPLTIDNWTRERGIKYLAIPDLYGIGETDDYMFFVIKNLGRVFAPKDTESVFEACVTMINTLEFIHSRGFTHGKIEPRNILIRNKRLSLIDYSRTNKLYKSGNSHIDYNEDMITSGNINYMCVDNHLGATVSRRGDLEMLGYCMIEWFGGKLPWKNESSIKVIKQKKEYKKFIATFFEDCFPEGNEPLELVRYIELVYTLDYSQTPNYDRLRRLFIQD

MW: 40.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Pseudokinase that plays a role in viral DNA replication repression by activating the antiviral protein BANF1 and inhibiting the activity of host VRK1, a cellular modulator of BANF1.

Reference: "The complete DNA sequence of vaccinia virus." Goebel S.J., Johnson G.P., Perkus M.E., Davis S.W., Winslow J.P., Paoletti E. Virology 179: 247-266(1990)

Function: