Gene Bio Systems
Recombinant Vaccinia virus Protein J5(MVA089L, ACAM3000_MVA_089)
Recombinant Vaccinia virus Protein J5(MVA089L, ACAM3000_MVA_089)
SKU:CSB-CF758850VEE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vaccinia virus (strain Ankara) (VACV)
Uniprot NO.:Q76VD9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTDEQIYAFCDANKDDIRCKCIYPDKSIVRIGIDTRLPYYCWYEPCKRSDALLPASLKKN ITKCNVSDCTISLGNVSITDSKLDVNNVCDSKRVATENIAVRYLNQEIRYPIIDIKWLPI GLLALAILILAFF
Protein Names:Recommended name: Protein J5
Gene Names:Ordered Locus Names:MVA089L, ACAM3000_MVA_089
Expression Region:1-133
Sequence Info:full length protein
