Gene Bio Systems
Recombinant Vaccinia virus Late protein H7 (VACWR105)
Recombinant Vaccinia virus Late protein H7 (VACWR105)
SKU:CSB-CF357429VAI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Uniprot NO.:P08586
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEMDKRMKSLAMTAFFGELSTLDIMALIMSIFKRHPNNTIFSVDKDGQFMIDFEYDNYKA SQYLDLTLTPISGDECKTHASSIAEQLACVDIIKEDISEYIKTTPRLKRFIKKYRNRSDT RISRDTEKLKIALAKGIDYEYIKDAC
Protein Names:Recommended name: Late protein H7 Alternative name(s): Protein H8
Gene Names:Ordered Locus Names:VACWR105 ORF Names:H7R
Expression Region:1-146
Sequence Info:full length protein
