Recombinant V-type proton ATPase subunit e(vha-17)

SKU: CSB-CF631328CXY

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q20591

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGILIPLVSVSAFWAIIGFGGPWIVPKGPNRGIIQLMIIMTAVCCWMFWIMVFLHQLNPL IGPQINVKTIRWISEKWGDAPNVINN

Protein Names:Recommended name: V-type proton ATPase subunit e Short name= V-ATPase subunit e Alternative name(s): Vacuolar proton pump subunit e

Gene Names:Name:vha-17 ORF Names:F49C12.13

Expression Region:1-86

Sequence Info:full length protein