Gene Bio Systems
Recombinant UPF0756 membrane protein YPO3057-y1423-YP_2679(YPO3057, y1423, YP_2679)
Recombinant UPF0756 membrane protein YPO3057-y1423-YP_2679(YPO3057, y1423, YP_2679)
SKU:CSB-CF751698YAS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pestis
Uniprot NO.:Q74SD5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAALDPTLLILLALAALGILSHNMTVTLAILILIAIRITPLNSFFPWVEKYGLTIGVLIL TIGVMAPIASGKISASEVLHSFVQWKSILAIVVGVAVSWLGGRGVSLMTHQPSVVAGLLV GTVLGVALFKGVPVGPLIAAGLLSLVIGKS
Protein Names:Recommended name: UPF0756 membrane protein YPO3057/y1423/YP_2679
Gene Names:Ordered Locus Names:YPO3057, y1423, YP_2679
Expression Region:1-150
Sequence Info:full length protein
