Gene Bio Systems
Recombinant UPF0344 protein BA_1155-GBAA_1155-BAS1072(BA_1155, GBAA_1155, BAS1072)
Recombinant UPF0344 protein BA_1155-GBAA_1155-BAS1072(BA_1155, GBAA_1155, BAS1072)
SKU:CSB-CF800539BQE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus anthracis
Uniprot NO.:Q81TV2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMGIMKTATS NMHMWYGLKMIAGILVIGGMEMVLVKMSKNKATGAVWGLFIVALVAVFYLGLKLPIGWQV F
Protein Names:Recommended name: UPF0344 protein BA_1155/GBAA_1155/BAS1072
Gene Names:Ordered Locus Names:BA_1155, GBAA_1155, BAS1072
Expression Region:1-121
Sequence Info:full length protein
