Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0344 protein BA_1155-GBAA_1155-BAS1072(BA_1155, GBAA_1155, BAS1072)

Recombinant UPF0344 protein BA_1155-GBAA_1155-BAS1072(BA_1155, GBAA_1155, BAS1072)

SKU:CSB-CF800539BQE

Regular price €1.408,95 EUR
Regular price Sale price €1.408,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:Q81TV2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMGIMKTATS NMHMWYGLKMIAGILVIGGMEMVLVKMSKNKATGAVWGLFIVALVAVFYLGLKLPIGWQV F

Protein Names:Recommended name: UPF0344 protein BA_1155/GBAA_1155/BAS1072

Gene Names:Ordered Locus Names:BA_1155, GBAA_1155, BAS1072

Expression Region:1-121

Sequence Info:full length protein

View full details