Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0114 protein in repA1-repA2 intergenic region

Recombinant UPF0114 protein in repA1-repA2 intergenic region

SKU:CSB-CF861740BFAV

Regular price €1.447,95 EUR
Regular price Sale price €1.447,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Geoica urticularia

Uniprot NO.:Q9F4E2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKLIEKIIYASRWLMFPVYIGLSFGFILLTLKFFQQIILVIPKILIMSESGLILIVLSL IDIALVGGLLVMVMFSGYENFISKMEINVDKKKLGWMGTMDVNSIKNKVASSIVAISSVH LLRLFMDADKISNDKIMWCVIIHLTFVLSAFGMACIDKMSKKNYS

Protein Names:Recommended name: UPF0114 protein in repA1-repA2 intergenic region

Gene Names:

Expression Region:1-165

Sequence Info:full length protein

View full details