Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein ygiM(ygiM)

Recombinant Uncharacterized protein ygiM(ygiM)

SKU:CSB-CF360005EOD

Regular price €1.467,95 EUR
Regular price Sale price €1.467,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:P0ADU0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:EETRYVSDELNTWVRSGPGDHYRLVGTVNAGEEVTLLQTDANTNYAQVKDSSGRTAWIPL KQLSTEPSLRSRVPDLENQVKTLTDKLTNIDNTWNQRTAEMQQKVAQSDSVINGLKEENQ KLKNELIVAQKKVDAASVQLDDKQRTIIMQWFMYGGGVLGLGLLLGLVLPHLIPSRKRKD RWMN

Protein Names:Recommended name: Uncharacterized protein ygiM

Gene Names:Name:ygiM Ordered Locus Names:Z4408, ECs3938

Expression Region:23-206

Sequence Info:full length protein

View full details