Gene Bio Systems
Recombinant Uncharacterized protein Rv2273-MT2334 (Rv2273, MT2334)
Recombinant Uncharacterized protein Rv2273-MT2334 (Rv2273, MT2334)
SKU:CSB-CF355016MVZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium tuberculosis
Uniprot NO.:P64971
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNRHSTAASDRGLQAERTTLAWTRTAFALLVNGVLLTLKDTQGADGPAGLIPAGLAGAAA SCCYVIALQRQRALSHRPLPARITPRGQVHILATAVLVLMVVTAFAQLL
Protein Names:Recommended name: Uncharacterized protein Rv2273/MT2334
Gene Names:Ordered Locus Names:Rv2273, MT2334 ORF Names:MTCY339.37c
Expression Region:1-109
Sequence Info:full length protein
