Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv2081c-MT2143(Rv2081c, MT2143)

Recombinant Uncharacterized protein Rv2081c-MT2143(Rv2081c, MT2143)

SKU:CSB-CF611995MVZ

Regular price €1.428,95 EUR
Regular price Sale price €1.428,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:Q10689

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFANAGLSPFVAIWTARAASLYTSHNFWCAAAVSAAVYVGSAVVPAAVAGPLFVGRVSAT IKAAAPSTTAAIATLATAANGQLRERGGAGGWVGVHCPVVGGGGVGHPRKAIAAAVSVHS TCMPAAFGGHLGLGDRSRSVSLSGTP

Protein Names:Recommended name: Uncharacterized protein Rv2081c/MT2143

Gene Names:Ordered Locus Names:Rv2081c, MT2143 ORF Names:MTCY49.20c

Expression Region:1-146

Sequence Info:full length protein

View full details