Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein pXO2-18-BXB0017-GBAA_pXO2_0017(pXO2-18, BXB0017, GBAA_pXO2_0017)

Recombinant Uncharacterized protein pXO2-18-BXB0017-GBAA_pXO2_0017(pXO2-18, BXB0017, GBAA_pXO2_0017)

SKU:CSB-CF890165BQE

Regular price €1.378,95 EUR
Regular price Sale price €1.378,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:Q9RN14

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLFTIFAMKLLTYNDFFDSVSSALTSWTGKLQGLGIAVIIFCVCIIAFMFMFGEGPSRT AKKWLLYIVVGGVLLWGAGTFASTVQGVTAGF

Protein Names:Recommended name: Uncharacterized protein pXO2-18/BXB0017/GBAA_pXO2_0017

Gene Names:Ordered Locus Names:pXO2-18, BXB0017, GBAA_pXO2_0017

Expression Region:1-92

Sequence Info:full length protein

View full details