Gene Bio Systems
Recombinant Uncharacterized protein pXO2-11-BXB0010-GBAA_pXO2_0010(pXO2-11, BXB0010, GBAA_pXO2_0010)
Recombinant Uncharacterized protein pXO2-11-BXB0010-GBAA_pXO2_0010(pXO2-11, BXB0010, GBAA_pXO2_0010)
SKU:CSB-CF870888BQE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus anthracis
Uniprot NO.:Q9RN21
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEMMRNPKNTKQEIKLAFFYIIDGAIIALMLVLASYMPKVVPVGGFGRIMFYVLFGTFGL FLCIKPHNSPTNRNIFVILDMLKMDNKNYHPIEVNTISSETKRK
Protein Names:Recommended name: Uncharacterized protein pXO2-11/BXB0010/GBAA_pXO2_0010
Gene Names:Ordered Locus Names:pXO2-11, BXB0010, GBAA_pXO2_0010
Expression Region:1-104
Sequence Info:full length protein
