Gene Bio Systems
Recombinant Uncharacterized protein ML0030 (ML0030)
Recombinant Uncharacterized protein ML0030 (ML0030)
SKU:CSB-CF518403MVN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium leprae
Uniprot NO.:O32871
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIMLAAGGVVALVA VAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATSCGKNCAGCILSCR
Protein Names:Recommended name: Uncharacterized protein ML0030
Gene Names:Ordered Locus Names:ML0030 ORF Names:MLB1770.18c
Expression Region:1-113
Sequence Info:full length protein
