Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized membrane protein Rv1401-MT1445 (Rv1401, MT1445)

Recombinant Uncharacterized membrane protein Rv1401-MT1445 (Rv1401, MT1445)

SKU:CSB-CF353804MVZ

Regular price €1.483,95 EUR
Regular price Sale price €1.483,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P64837

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLQPAFKASMAVLLAAAAVAHPIGRERRWLVPALLLSATGDWLLAIPWWTWAFVFGLGAF LLAHLCFIGALLPLARQAAPSRGRVAAVVAMCVASAGLLVWFWPHLGKDNLTIPVTVYIV ALSAMVCTALLARLPTIWTAVGAVCFAASDSMIGIGRFILGNEALAVPIWWSYAAAEILI TAGFFFGREVPDNAAAPTDS

Protein Names:Recommended name: Uncharacterized membrane protein Rv1401/MT1445

Gene Names:Ordered Locus Names:Rv1401, MT1445 ORF Names:MTCY21B4.18

Expression Region:1-200

Sequence Info:full length protein

View full details