Gene Bio Systems
Recombinant Tropheryma whipplei UPF0233 membrane protein TWT_010 (TWT_010)
Recombinant Tropheryma whipplei UPF0233 membrane protein TWT_010 (TWT_010)
SKU:CSB-CF302967TIW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Tropheryma whipplei (strain Twist) (Whipple's bacillus)
Uniprot NO.:P67378
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSRKKHESSENNPVWFPTIMFGLMGTGAVWMVLFYISNGALPLPAVGTWNILIAFGIIMA GFAMMSRWK
Protein Names:Recommended name: UPF0233 membrane protein TWT_010
Gene Names:Ordered Locus Names:TWT_010
Expression Region:1-69
Sequence Info:full length protein
