Skip to product information
1 of 1

Gene Bio Systems

Recombinant Triticum aestivum Granule-bound starch synthase 1,chloroplastic-amyloplastic(WAXY),partial

Recombinant Triticum aestivum Granule-bound starch synthase 1,chloroplastic-amyloplastic(WAXY),partial

SKU:CSB-EP333285TQN

Regular price €1.022,95 EUR
Regular price Sale price €1.022,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P27736

Gene Names: WAXY

Organism: Triticum aestivum (Wheat)

AA Sequence: LVFVGAEMAPWSKTGGLGDVLGGLPAAMAANGHRVMVISPRYDQYKDAWDTSVISEIKVVDRYERVRYFHCYKRGVDRVFVDHPCFLEKVRGKTKEKIYGPDAGTDYEDNQQRFSLLCQAALEVPRILDLNNNPHFSGPYAMLCRAVPRRAGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTAKVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQADKVLTVSPYYAEELISGEARGCELDNIMR

Expression Region: 79-349aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 35.8 kDa

Alternative Name(s): Granule-bound starch synthase I Short name: GBSS-I

Relevance:

Reference: "Wheat granule-bound starch synthase I and II are encoded by separate genes that are expressed in different tissues." Vrinten P.L., Nakamura T. Plant Physiol. 122:255-264(2000)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details