
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: others
Target / Protein: hfb2
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Hypocrea jecorina (Trichoderma reesei)
Delivery time: 3-7 business days
Uniprot ID: P79073
AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF
Tag info: N-terminal 6xHis-sumostar-tagged
Expression Region: 16-86aa
Protein length: Full Length of Mature Protein
MW: 23.2 kDa
Alternative Name(s): Hydrophobin II
Relevance: Responsible for spore hydrophobicity and protection.
Reference: "Differential expression of the vegetative and spore-bound hydrophobins of Trichoderma reesei: cloning and characterization of the hfb2 gene." Nakari-Setaelae T., Aro N., Ilmen M., Munoz G., Kalkkinen N., Penttilae M. Eur. J. Biochem. 248:415-423(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Hypocrea jecorina Hydrophobin-2(hfb2)
- Regular price
- €751,95 EUR
- Sale price
- €751,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Trichoderma reesei Hydrophobin-2(hfb2)
- Regular price
- €639,95 EUR
- Sale price
- €639,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Hypocrea jecorina Hydrophobin-2(hfb2)
- Regular price
- €751,95 EUR
- Sale price
- €751,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Hypocrea jecorina Hydrophobin-2(hfb2)
- Regular price
- €824,95 EUR
- Sale price
- €824,95 EUR
- Regular price
-
- Unit price
- per
Sold out