Recombinant Treponema pallidum Uncharacterized protein TP_0055 (TP_0055)

CSB-CF526891TPR

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Treponema pallidum (strain Nichols)

Uniprot NO.:O83094

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNQIRLFAQSALVSVMGMGMVFAFLLLLICVVRCVGALVSSFGWDRGPDEGVGAAVPAGG ALAAAIAVAVHEKARSTS

Protein Names:Recommended name: Uncharacterized protein TP_0055

Gene Names:Ordered Locus Names:TP_0055

Expression Region:1-78

Sequence Info:full length protein