Gene Bio Systems
Recombinant Toxocara canis 26 kDa secreted antigen(TES-26)
Recombinant Toxocara canis 26 kDa secreted antigen(TES-26)
SKU:CSB-YP347478THA
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: TES-26
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Toxocara canis (Canine roundworm)
Delivery time: 3-7 business days
Uniprot ID: P54190
AA Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Tag info: N-terminal 6xHis-tagged
Expression Region: 22-262aa
Protein length: Full Length of Mature Protein
MW: 27.9 kDa
Alternative Name(s): Toxocara excretory-secretory antigen 26 ;TES-26
Relevance: Binds phosphatidylethanolamine.
Reference: An abundant, trans-spliced mRNA from Toxocara canis infective larvae encodes a 26-kDa protein with homology to phosphatidylethanolamine-binding proteins.Gems D., Ferguson C.J., Robertson B.D., Nieves R., Page A.P., Blaxter M.L., Maizels R.M.J. Biol. Chem. 270:18517-18522(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
