Skip to product information
1 of 1

Gene Bio Systems

Recombinant Tolumonas auensis Electron transport complex protein RnfA(rnfA)

Recombinant Tolumonas auensis Electron transport complex protein RnfA(rnfA)

SKU:CSB-CF505065TOQ

Regular price €1.476,95 EUR
Regular price Sale price €1.476,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Tolumonas auensis (strain DSM 9187 / TA4)

Uniprot NO.:C4LEP7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLEYLLLLISTVLVNNFVLVKFLGLCPFMGVSKKIEPAVGMGLATTFVLTLTSAFAYLVQ HYLLVPLAAESLSTLAFILVIAVVVQFTEMVIHKSAPDLYRILGIYLPLITTNCIVLGLA LLNITMQHNFMQSVVYGFGGGLGFMLVLILFASLRERLAAADVPAPFQGIAIGMVTAGLM SLAFLGFTGLIKL

Protein Names:Recommended name: Electron transport complex protein RnfA

Gene Names:Name:rnfA Ordered Locus Names:Tola_1449

Expression Region:1-193

Sequence Info:full length protein

View full details