Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thioalkalivibrio sp. Probable intracellular septation protein A (Tgr7_2018)

Recombinant Thioalkalivibrio sp. Probable intracellular septation protein A (Tgr7_2018)

SKU:CSB-CF490027TNX

Regular price €1.491,95 EUR
Regular price Sale price €1.491,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Thioalkalivibrio sp. (strain HL-EbGR7)

Uniprot NO.:B8GT83

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLLYDLLPVILFFLAYKFYGALPPEWILAVGVWLPVALEPDNPGHAIYLATAVAMVVMA VQLALGLAIKRRLETMPLLTAAVILVLGGATLWLHDPVFILWKPTLVNWLFALVFMAPPL FGRRTLVETLMGHALSVPRAIWSRVNLAWVVFFLVSGLANLFVAYTFSEAVWVDFKLFGM LGMTFVFVIGQAVYLGLHHREDDPHTTKGDPS

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Tgr7_2018

Expression Region:1-212

Sequence Info:full length protein

View full details