Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thermotoga maritima Probable glycerol uptake facilitator protein(glpF)

Recombinant Thermotoga maritima Probable glycerol uptake facilitator protein(glpF)

SKU:CSB-CF894430TNJ

Regular price €1.509,95 EUR
Regular price Sale price €1.509,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

Uniprot NO.:Q9X1E3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSVYLAEFLGTMLLIILGDGVVANVVLKKSKGHNSGWIVITTGWGLAVAMSVYLVGRISG AHINPAVTIGLAFIGQFPWSKVPGYIFSQILGAFVGAILVYLTYLPHWKETDDPDAKLAV FCTGPAVRKYGANLLTEIIGTMVLLMGVLGIGANKLADGLNPLLVGFLVWSIGLSLGGPT GYAINPARDFGPRLAHAILPIPGKRDSDWSYSWVPIIGPIIGGILGASLYNWLF

Protein Names:Recommended name: Probable glycerol uptake facilitator protein

Gene Names:Name:glpF Ordered Locus Names:TM_1429

Expression Region:1-234

Sequence Info:full length protein

View full details