Recombinant Thermodesulfovibrio yellowstonii ATP synthase subunit b(atpF)

SKU: CSB-CF002358TMY

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)

Uniprot NO.:B5YI20

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKGKMLLIFMMIVMIASSAMAAEAEHAGGDLKDWAFKVINFAILVFIIVKFLGKPIKNYFAQRKELIEKSIRESQEAKELAQKALQEVEEKLKLKDKEVQDILDTAKKIGEQEKIQIVQESEKLKEKILEQAKTNIEFEVKMAKDALRLEAAELAIQLSEQKLKEKITPEEQEKLLQESIKIIEGRKN

Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b

Gene Names:Name:atpF Ordered Locus Names:THEYE_A0237

Expression Region:1-188

Sequence Info:full length protein