Skip to product information
1 of 1

Gene Bio Systems

Recombinant Theragra chalcogramma Parvalbumin beta-1

Recombinant Theragra chalcogramma Parvalbumin beta-1

SKU:CSB-EP835477EAJ

Regular price €1.022,95 EUR
Regular price Sale price €1.022,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q90YK8

Gene Names: N/A

Organism: Theragra chalcogramma (Alaska pollock) (Gadus chalcogrammus)

AA Sequence: SFAGVLADADVKAALAGCAAADSFNYKTFFKACGLAAKSHEEVKKAFFVIDQDQSGFIEEDELKLFLQTFGAGARELTAAETKAFLAAGDEDGDGMIGVDEFVTLVKA

Expression Region: 2-109aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged

MW: 31.4 kDa

Alternative Name(s): Allergen: The c 1

Relevance: In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions (By similarity).

Reference: "Characterization of parvalbumin, the major allergen in Alaska pollack, and comparison with codfish Allergen M."Van Do T., Hordvik I., Endresen C., Elsayed S.Mol. Immunol. 42:345-353(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details