Skip to product information
1 of 1

Gene Bio Systems

Recombinant Takifugu rubripes Surfeit locus protein 1(surf1)

Recombinant Takifugu rubripes Surfeit locus protein 1(surf1)

SKU:CSB-CF022963TKY

Regular price €1.523,95 EUR
Regular price Sale price €1.523,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)

Uniprot NO.:O57593

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SFLKWFLLLIPATTFGLGTWQVKRRQWKMELIDGLTKLTTAEPIPLPIDPAELSSLEYRR VKMRGKYDHSKELYILPRSPVDPEKEAREAGRLSSSGETGANVITPFHVTDLGITILVNR GYVPKKKIRPETRMKGQVEGEMEVVGVVRLTETRKPFVPNNDVERNHWHYRDLEAMCQVT GAEPIFVDADFSSTVPGGPIGGQTRVTLRNEHMQYIVTWYGLCAATSYMWFAKFIKKIKV

Protein Names:Recommended name: Surfeit locus protein 1

Gene Names:Name:surf1 Synonyms:surf-1

Expression Region:1-240

Sequence Info:full length protein

View full details