Recombinant Takifugu pardalis Saxitoxin and tetrodotoxin-binding protein 1 (psbp1)

SKU: Q90WJ7

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Epigenetics and Nuclear Signaling

Uniprot ID: Q90WJ7

Gene Names: psbp1

Alternative Name(s):

Abbreviation: Recombinant Takifugu pardalis psbp1 protein

Organism: Takifugu pardalis (Panther puffer) (Tetraodon pardalis)

Source: E.coli

Expression Region: 21-391aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: APAPEECHKLTKPVTKADVQSVSGDWVLVWSVANTTERWICENLTSSYVEFKLHSDIIEYTERNLFLGNSCISFYSNLSASTEKQQQFSLNNLQMEEKGVVRPFNDNGTVKFFETCVDCLSMEYSGDIGRFLLIYRRDGVHQNVEVLKAAQDESQKLAECLGFSIDEPFIYDGVSDFCHKKSPEECHKLTKPVTKADVQSVSGDWVLVWSIDENSTISDDWKKLKTSYVEQRVDSGVIRFTERNMLKNNSCMTFKTNMTAGPESQNTFIYTSGKMEENGVVTVLDENGTVKFFETCADCLSMEYSGFFGHFLLIYRRDGVHQNVEVLKAAQDESQKLAECLGFSIDEPFIYDGVSDFCHKKSSPEVKPEQD

MW: 49.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Binds both saxitoxin and tetradotoxin. May play a role in toxin accumulation and/or excretion.

Reference: "Purification, characterization, and cDNA cloning of a novel soluble saxitoxin and tetrodotoxin binding protein from plasma of the puffer fish, Fugu pardalis." Yotsu-Yamashita M., Sugimoto A., Terakawa T., Shoji Y., Miyazawa T., Yasumoto T. Eur. J. Biochem. 268: 5937-5946(2001)

Function: